PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.K01504.1.p
Common NameEUGRSUZ_K01504
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 269aa    MW: 30385.7 Da    PI: 7.6653
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.K01504.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.43.3e-182774148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg+WT+eEde+l+ +vk+ G g+W+t +++ g+ R++k+c++rw +yl
  Eucgr.K01504.1.p 27 RGPWTPEEDEILASYVKKEGEGRWRTLPKRAGLMRCGKSCRLRWMNYL 74
                      89********************************************97 PP

2Myb_DNA-binding47.44.6e-1585125648
                       HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       ++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l
  Eucgr.K01504.1.p  85 PDEEDLILRLHRLLGNR-WSLIAGRIP-GRTDNEIKNYWNTHL 125
                       89***************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-231876IPR009057Homeodomain-like
PROSITE profilePS5129417.5382274IPR017930Myb domain
SuperFamilySSF466891.8E-2924121IPR009057Homeodomain-like
SMARTSM007178.8E-132676IPR001005SANT/Myb domain
PfamPF002493.3E-162774IPR001005SANT/Myb domain
CDDcd001671.90E-112974No hitNo description
PROSITE profilePS5129424.39775129IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-2477130IPR009057Homeodomain-like
SMARTSM007172.7E-1379127IPR001005SANT/Myb domain
CDDcd001671.64E-1185125No hitNo description
PfamPF002497.6E-1485125IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MRNPSSSSSS NSPSKPTPCC SKVGIKRGPW TPEEDEILAS YVKKEGEGRW RTLPKRAGLM  60
RCGKSCRLRW MNYLRPSVKR GQIAPDEEDL ILRLHRLLGN RWSLIAGRIP GRTDNEIKNY  120
WNTHLSKKLI SQGIDPRTHK PLELIPNMPT SDDHDFAPAS ISPQNPTASE FQVTNGDHYQ  180
VAITDNTQDP KDVMTNLQDL HQNPRVDHQG GVNQNWQNLD GSAIRAGSSS HRSEAQTHAQ  240
FYMDNSNEDV FSSFLDSLIN EDGYTNQHQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-25271297108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.K01504.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010036229.10.0PREDICTED: transcription repressor MYB6-like
TrEMBLA0A059A2370.0A0A059A237_EUCGR; Uncharacterized protein (Fragment)
STRINGPOPTR_0013s05310.11e-106(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.14e-77myb domain protein 5